PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4809890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 393aa    MW: 44289.4 Da    PI: 7.8468
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4809890.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++++q+G g+W+++++  g+ R++k+c++rw +yl
  Lj1g3v4809890.1 14 KGLWSPDEDEKLLNYITQHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding42.31.7e-1367110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E++ ++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Lj1g3v4809890.1  67 RGAFSQQEEDSIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.471965IPR017930Myb domain
SuperFamilySSF466891.57E-2812108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001672.62E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2465116IPR009057Homeodomain-like
SMARTSM007171.2E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129418.59866116IPR017930Myb domain
PfamPF002492.0E-1267110IPR001005SANT/Myb domain
CDDcd001675.41E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPD EDEKLLNYIT QHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEEDSIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS SLKKKLRQRG  120
IDPNTHQPLC EVEIIKDKDY KEPTPDNKTI HKASVGSNHE MINSLIDPPK QKATTSISIE  180
RYHPLQMSST SNNIINNNTT STQELFQDKF GTTCHDQGYF SFYGSPNMGN IPSSFCFIPG  240
SSTSDLNNSS TINFSMLNSV STSILPKHVK SNNPSISSDS SSITQLQNST NFYDAQSHHH  300
VPLQAELQQE GIKWSEYLNT PLFLGNAAVK NQSTTTTTTT QSIYSSDEVI KPAEPSGFIT  360
DESSTTWHQH HFQPLDLYTK DMQRFSVAFG QTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311861e-131KT031186.1 Glycine max clone HN_CCL_14 MYB/HD-like transcription factor (Glyma03g38660.2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512306.11e-145PREDICTED: transcription factor MYB86
TrEMBLA0A0L9TYC91e-149A0A0L9TYC9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SQS21e-149A0A0S3SQS2_PHAAN; Uncharacterized protein
STRINGGLYMA20G22230.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.17e-79myb domain protein 61